Human TLR8 protein

Artikelnummer: BYT-ORB246018
Artikelname: Human TLR8 protein
Artikelnummer: BYT-ORB246018
Hersteller Artikelnummer: orb246018
Alternativnummer: BYT-ORB246018-1,BYT-ORB246018-100,BYT-ORB246018-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: TLR8
This Human TLR8 protein spans the amino acid sequence from region 27-827. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 93.5 kDa
UniProt: Q9NR97
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: EENFSRSYPCDEKKQNDSVIAECSNRRLQEVPQTVGKYVTELDLSDNFITHITNESFQGLQNLTKINLNHNPNVQHQNGNPGIQSNGLNITDGAFLNLKNLRELLLEDNQLPQIPSGLPESLTELSLIQNNIYNITKEGISRLINLKNLYLAWNCYFNKVCEKTNIEDGVFETLTNLELLSLSFNSLSHVPPKLPSSLRKLFLSNTQIKYISEEDFKGLINLTLLDLSGNCPRCFNAPFPCVPCDGGASINIDRF
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
The purity of TLR8 was greater than 90% as determined by SEC-HPLC