Human TLR8 protein

Catalog Number: BYT-ORB246018
Article Name: Human TLR8 protein
Biozol Catalog Number: BYT-ORB246018
Supplier Catalog Number: orb246018
Alternative Catalog Number: BYT-ORB246018-1,BYT-ORB246018-100,BYT-ORB246018-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: TLR8
This Human TLR8 protein spans the amino acid sequence from region 27-827. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 93.5 kDa
UniProt: Q9NR97
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: EENFSRSYPCDEKKQNDSVIAECSNRRLQEVPQTVGKYVTELDLSDNFITHITNESFQGLQNLTKINLNHNPNVQHQNGNPGIQSNGLNITDGAFLNLKNLRELLLEDNQLPQIPSGLPESLTELSLIQNNIYNITKEGISRLINLKNLYLAWNCYFNKVCEKTNIEDGVFETLTNLELLSLSFNSLSHVPPKLPSSLRKLFLSNTQIKYISEEDFKGLINLTLLDLSGNCPRCFNAPFPCVPCDGGASINIDRF
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
The purity of TLR8 was greater than 90% as determined by SEC-HPLC