Yeast zot protein

Produktübersicht

• Artikelname: Yeast zot protein
• Artikelnummer: BYT-ORB246074
• Hersteller Artikelnummer: orb246074
• Alternativnummer: BYT-ORB246074-1,BYT-ORB246074-100,BYT-ORB246074-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: zot

Produktbeschreibung

This Yeast zot protein spans the amino acid sequence from region 1-399aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 46.9 kDa
• UniProt: P38442
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MSIFIHHGAPGSYKTSGALWLRLLPAIKSGRHIITNVRGLNLERMAKYLKMDVSDISIEFIDTDHPDGRLTMARFWHWARKDAFLFIDECGRIWPPRLTVTNLKALDTPPDLVAEDRPESFEVAFDMHRHHGWDICLTTPNIAKVHNMIREAAEIGYRHFNRATVGLGAKFTLTTHDAANSGQMDSHALTRQVKKIPSPIFKMYASTTTGKARDTMAGTALWKDRKILFLFGMVFLMFSYSFYGLHDNPIFTGGN

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961). Application Notes: This is His-tag protein

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

SDS-Page analysis of Yeast zot protein.