Yeast zot protein

Catalog Number: BYT-ORB246074
Article Name: Yeast zot protein
Biozol Catalog Number: BYT-ORB246074
Supplier Catalog Number: orb246074
Alternative Catalog Number: BYT-ORB246074-1,BYT-ORB246074-100,BYT-ORB246074-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: zot
This Yeast zot protein spans the amino acid sequence from region 1-399aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 46.9 kDa
UniProt: P38442
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSIFIHHGAPGSYKTSGALWLRLLPAIKSGRHIITNVRGLNLERMAKYLKMDVSDISIEFIDTDHPDGRLTMARFWHWARKDAFLFIDECGRIWPPRLTVTNLKALDTPPDLVAEDRPESFEVAFDMHRHHGWDICLTTPNIAKVHNMIREAAEIGYRHFNRATVGLGAKFTLTTHDAANSGQMDSHALTRQVKKIPSPIFKMYASTTTGKARDTMAGTALWKDRKILFLFGMVFLMFSYSFYGLHDNPIFTGGN
Application Notes: Biological Origin: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
SDS-Page analysis of Yeast zot protein.