Human VP1 protein

Produktübersicht

• Artikelname: Human VP1 protein
• Artikelnummer: BYT-ORB246116
• Hersteller Artikelnummer: orb246116
• Alternativnummer: BYT-ORB246116-1,BYT-ORB246116-100,BYT-ORB246116-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: VP1

Produktbeschreibung

This Human VP1 protein spans the amino acid sequence from region 575-866aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 34.6 kDa
• UniProt: P07210
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Human rhinovirus A serotype 89 (strain 41467-Gallo) (HRV-89)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: NPVENYIDSVLNEVLVVPNIQPSTSVSSHAAPALDAAETGHTSSVQPEDMIETRYVITDQTRDETSIESFLGRSGCIAMIEFNTSSDKTEHDKIGKGFKTWKVSLQEMAQIRRKYELFTYTRFDSEITIVTAAAAQGNDSGHIVLQFMYVPPGAPVPEKRDDYTWQSGTNASVFWQEGQPYPRFTIPFMSIASAYYMFYDGYDGDSAASKYGSVVTNDMGTICVRIVTSNQKHDSNIVCRIYHKAKHIKAWCPRP

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Human rhinovirus A serotype 89 (strain 41467-Gallo) (HRV-89). Application Notes: This is His-tag protein

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human).

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human).