Human VP1 protein
Artikelnummer:
BYT-ORB246116
- Bilder (3)
| Artikelname: | Human VP1 protein |
| Artikelnummer: | BYT-ORB246116 |
| Hersteller Artikelnummer: | orb246116 |
| Alternativnummer: | BYT-ORB246116-1,BYT-ORB246116-100,BYT-ORB246116-20 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | VP1 |
| This Human VP1 protein spans the amino acid sequence from region 575-866aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molekulargewicht: | 34.6 kDa |
| UniProt: | P07210 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Human rhinovirus A serotype 89 (strain 41467-Gallo) (HRV-89) |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | NPVENYIDSVLNEVLVVPNIQPSTSVSSHAAPALDAAETGHTSSVQPEDMIETRYVITDQTRDETSIESFLGRSGCIAMIEFNTSSDKTEHDKIGKGFKTWKVSLQEMAQIRRKYELFTYTRFDSEITIVTAAAAQGNDSGHIVLQFMYVPPGAPVPEKRDDYTWQSGTNASVFWQEGQPYPRFTIPFMSIASAYYMFYDGYDGDSAASKYGSVVTNDMGTICVRIVTSNQKHDSNIVCRIYHKAKHIKAWCPRP |
| Anwendungsbeschreibung: | Biological Origin: Human rhinovirus A serotype 89 (strain 41467-Gallo) (HRV-89). Application Notes: This is His-tag protein |



