Human VP1 protein

Product Overview

• Article Name: Human VP1 protein
• Biozol Catalog Number: BYT-ORB246116
• Supplier Catalog Number: orb246116
• Alternative Catalog Number: BYT-ORB246116-1,BYT-ORB246116-100,BYT-ORB246116-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: VP1

Product Description

This Human VP1 protein spans the amino acid sequence from region 575-866aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 34.6 kDa
• UniProt: P07210
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Human rhinovirus A serotype 89 (strain 41467-Gallo) (HRV-89)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: NPVENYIDSVLNEVLVVPNIQPSTSVSSHAAPALDAAETGHTSSVQPEDMIETRYVITDQTRDETSIESFLGRSGCIAMIEFNTSSDKTEHDKIGKGFKTWKVSLQEMAQIRRKYELFTYTRFDSEITIVTAAAAQGNDSGHIVLQFMYVPPGAPVPEKRDDYTWQSGTNASVFWQEGQPYPRFTIPFMSIASAYYMFYDGYDGDSAASKYGSVVTNDMGTICVRIVTSNQKHDSNIVCRIYHKAKHIKAWCPRP

Application Notes

• Application Notes: Biological Origin: Human rhinovirus A serotype 89 (strain 41467-Gallo) (HRV-89). Application Notes: This is His-tag protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human).

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human).