E.coli Pectate lyase 1 protein

Artikelnummer: BYT-ORB246276
Artikelname: E.coli Pectate lyase 1 protein
Artikelnummer: BYT-ORB246276
Hersteller Artikelnummer: orb246276
Alternativnummer: BYT-ORB246276-1,BYT-ORB246276-100,BYT-ORB246276-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Pectate lyase 1, EC 4.2.2.2, Major pollen allergen Cha o 1, allergen Cha o 1
This E.coli Pectate lyase 1 protein spans the amino acid sequence from region 22-375aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 54.1 kDa
UniProt: Q96385
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Chamaecyparis obtusa (Hinoki false-cypress)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: DNPIDSCWRGDANWDQNRMKLADCAVGFGSSAMGGKGGAFYTVTSSDDDPVNPAPGTLRYGATRERSLWIIFSKNLNIKLNMPLYIAGNKTIDGRGAEVHIGNGGPCLFMRTVSHVILHGLNIHGCNTSVSGNVLISEASGVVPVHAQDGDAITMRNVTDVWIDHNSLSDSSDGLVDVTLASTGVTISNNHFFNHHKVMLLGHSDIYSDDKSMKVTVAFNQFGPNAGQRMPRARYGLIHVANNNYDPWSIYAIGG
Anwendungsbeschreibung: Biological Origin: Chamaecyparis obtusa (Hinoki false-cypress). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Chamaecyparis obtusa (Hinoki false-cypress).
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Chamaecyparis obtusa (Hinoki false-cypress).