E.coli Pectate lyase 1 protein

Product Overview

• Article Name: E.coli Pectate lyase 1 protein
• Biozol Catalog Number: BYT-ORB246276
• Supplier Catalog Number: orb246276
• Alternative Catalog Number: BYT-ORB246276-1,BYT-ORB246276-100,BYT-ORB246276-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Pectate lyase 1, EC 4.2.2.2, Major pollen allergen Cha o 1, allergen Cha o 1

Product Description

This E.coli Pectate lyase 1 protein spans the amino acid sequence from region 22-375aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 54.1 kDa
• UniProt: Q96385
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Chamaecyparis obtusa (Hinoki false-cypress)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: DNPIDSCWRGDANWDQNRMKLADCAVGFGSSAMGGKGGAFYTVTSSDDDPVNPAPGTLRYGATRERSLWIIFSKNLNIKLNMPLYIAGNKTIDGRGAEVHIGNGGPCLFMRTVSHVILHGLNIHGCNTSVSGNVLISEASGVVPVHAQDGDAITMRNVTDVWIDHNSLSDSSDGLVDVTLASTGVTISNNHFFNHHKVMLLGHSDIYSDDKSMKVTVAFNQFGPNAGQRMPRARYGLIHVANNNYDPWSIYAIGG

Application Notes

• Application Notes: Biological Origin: Chamaecyparis obtusa (Hinoki false-cypress). Application Notes: This is His-SUMO-tag protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Chamaecyparis obtusa (Hinoki false-cypress).

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Chamaecyparis obtusa (Hinoki false-cypress).