Rat Prss1 protein

Artikelnummer: BYT-ORB246418
Artikelname: Rat Prss1 protein
Artikelnummer: BYT-ORB246418
Hersteller Artikelnummer: orb246418
Alternativnummer: BYT-ORB246418-1,BYT-ORB246418-100,BYT-ORB246418-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Prss1
This Rat Prss1 protein spans the amino acid sequence from region 24-246aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 39.6 kDa
UniProt: P00762
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Rattus norvegicus (Rat)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: IVGGYTCPEHSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKLNARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAYPGEITSSMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALPDNPGVYTKVCNFVGWIQDTIAAN
Anwendungsbeschreibung: Biological Origin: Rattus norvegicus (Rat). Application Notes: Full length of His-SUMO-tag and expression region is 24-246aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Prss1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Prss1.