Rat Prss1 protein

Product Overview

• Article Name: Rat Prss1 protein
• Biozol Catalog Number: BYT-ORB246418
• Supplier Catalog Number: orb246418
• Alternative Catalog Number: BYT-ORB246418-1,BYT-ORB246418-100,BYT-ORB246418-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Prss1

Product Description

This Rat Prss1 protein spans the amino acid sequence from region 24-246aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 39.6 kDa
• UniProt: P00762
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Rattus norvegicus (Rat)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: IVGGYTCPEHSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKLNARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAYPGEITSSMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALPDNPGVYTKVCNFVGWIQDTIAAN

Application Notes

• Application Notes: Biological Origin: Rattus norvegicus (Rat). Application Notes: Full length of His-SUMO-tag and expression region is 24-246aa

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Prss1.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Prss1.