E.coli ply protein
Artikelnummer:
BYT-ORB246483
- Bilder (3)
| Artikelname: | E.coli ply protein |
| Artikelnummer: | BYT-ORB246483 |
| Hersteller Artikelnummer: | orb246483 |
| Alternativnummer: | BYT-ORB246483-1,BYT-ORB246483-100,BYT-ORB246483-20 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | ply |
| This E.coli ply protein spans the amino acid sequence from region 2-471aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molekulargewicht: | 68.8 kDa |
| UniProt: | P0C2J9 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | ANKAVNDFILAMNYDKKKLLTHQGESIENRFIKEGNQLPDEFVVIERKKRSLSTNTSDISVTATNDSRLYPGALLVVDETLLENNPTLLAVDRAPMTYSIDLPGLASSDSFLQVEDPSNSSVRGAVNDLLAKWHQDYGQVNNVPARMQYEKITAHSMEQLKVKFGSDFEKTGNSLDIDFNSVHSGEKQIQIVNFKQIYYTVSVDAVKNPGDVFQDTVTVEDLKQRGISAERPLVYISSVAYGRQVYLKLETTSKS |
| Anwendungsbeschreibung: | Biological Origin: Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4). Application Notes: Full length of His-SUMO-tag and expression region is 2-471aa |



