E.coli ply protein

Catalog Number: BYT-ORB246483
Article Name: E.coli ply protein
Biozol Catalog Number: BYT-ORB246483
Supplier Catalog Number: orb246483
Alternative Catalog Number: BYT-ORB246483-1,BYT-ORB246483-100,BYT-ORB246483-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: ply
This E.coli ply protein spans the amino acid sequence from region 2-471aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 68.8 kDa
UniProt: P0C2J9
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ANKAVNDFILAMNYDKKKLLTHQGESIENRFIKEGNQLPDEFVVIERKKRSLSTNTSDISVTATNDSRLYPGALLVVDETLLENNPTLLAVDRAPMTYSIDLPGLASSDSFLQVEDPSNSSVRGAVNDLLAKWHQDYGQVNNVPARMQYEKITAHSMEQLKVKFGSDFEKTGNSLDIDFNSVHSGEKQIQIVNFKQIYYTVSVDAVKNPGDVFQDTVTVEDLKQRGISAERPLVYISSVAYGRQVYLKLETTSKS
Application Notes: Biological Origin: Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4). Application Notes: Full length of His-SUMO-tag and expression region is 2-471aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) ply.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) ply.