E.coli ply protein

Catalog Number: BYT-ORB246483
Article Name: E.coli ply protein
Biozol Catalog Number: BYT-ORB246483
Supplier Catalog Number: orb246483
Alternative Catalog Number: BYT-ORB246483-20, BYT-ORB246483-100, BYT-ORB246483-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: ply
Recombinant Streptococcus pneumoniae serotype 4 Pneumolysin
Molecular Weight: 68.8 kDa
UniProt: P0C2J9
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ANKAVNDFILAMNYDKKKLLTHQGESIENRFIKEGNQLPDEFVVIERKKRSLSTNTSDISVTATNDSRLYPGALLVVDETLLENNPTLLAVDRAPMTYSIDLPGLASSDSFLQVEDPSNSSVRGAVNDLLAKWHQDYGQVNNVPARMQYEKITAHSMEQLKVKFGSDFEKTGNSLDIDFNSVHSGEKQIQIVNFKQIYYTVSVDAVKNPGDVFQDTVTVEDLKQRGISAERPLVYISSVAYGRQVYLKLETTSK
Application Notes: Full length of His-SUMO-tag and expression region is 2-471aa