Glycoprotein G protein

Artikelnummer: BYT-ORB246535
Artikelname: Glycoprotein G protein
Artikelnummer: BYT-ORB246535
Hersteller Artikelnummer: orb246535
Alternativnummer: BYT-ORB246535-1,BYT-ORB246535-100,BYT-ORB246535-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Glycoprotein G protein
This Glycoprotein G protein spans the amino acid sequence from region 20-459aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 65.4 kDa
UniProt: A3RM22
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Rabies virus (strain PM) (RABV)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: KFPIYTIPDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSGFSYMELKVGYISAIKVNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYHWLRTVKTTKESLVIISPSVADLDPYDKSLHSRVFPSGKCSGITISSTYCSTNHDYTIWMPENPRLGTSCDIFTNSRGKRASKGGKTCGFVDERGLYKSLKGACKLKLCGVLGLRLMDGTWVAMQTSDETKWCPPD
Anwendungsbeschreibung: Biological Origin: Rabies virus (strain PM) (RABV). Application Notes: This is His-SUMO-tag protein
WB analysis of Glycoprotein G protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.