Glycoprotein G protein

Catalog Number: BYT-ORB246535
Article Name: Glycoprotein G protein
Biozol Catalog Number: BYT-ORB246535
Supplier Catalog Number: orb246535
Alternative Catalog Number: BYT-ORB246535-1,BYT-ORB246535-100,BYT-ORB246535-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Glycoprotein G protein
This Glycoprotein G protein spans the amino acid sequence from region 20-459aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 65.4 kDa
UniProt: A3RM22
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Rabies virus (strain PM) (RABV)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: KFPIYTIPDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSGFSYMELKVGYISAIKVNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYHWLRTVKTTKESLVIISPSVADLDPYDKSLHSRVFPSGKCSGITISSTYCSTNHDYTIWMPENPRLGTSCDIFTNSRGKRASKGGKTCGFVDERGLYKSLKGACKLKLCGVLGLRLMDGTWVAMQTSDETKWCPPD
Application Notes: Biological Origin: Rabies virus (strain PM) (RABV). Application Notes: This is His-SUMO-tag protein
WB analysis of Glycoprotein G protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.