Recombinant Human Sodium-dependent phosphate transport protein 2B (SLC34A2), partial

Artikelnummer: BYT-ORB246790
Artikelname: Recombinant Human Sodium-dependent phosphate transport protein 2B (SLC34A2), partial
Artikelnummer: BYT-ORB246790
Hersteller Artikelnummer: orb246790
Alternativnummer: BYT-ORB246790-1,BYT-ORB246790-100,BYT-ORB246790-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Na(+)-dependent phosphate cotransporter 2BNaPi3bSodium/phosphate cotransporter 2B , Na(+)/Pi cotransporter 2B , NaPi-2bSolute carrier family 34 member 2
This Recombinant Human Sodium-dependent phosphate transport protein 2B (SLC34A2), partial spans the amino acid sequence from region 574-689aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 15.1 kDa
UniProt: O95436
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: LLQSRCPRVLPKKLQNWNFLPLWMRSLKPWDAVVSKFTGCFQMRCCCCCRVCCRACCLLCDCPKCCRCSKCCEDLEEAQEGQDVPVKAPETFDNITISREAQGEVPASDSKTECTA
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
Western blot analysis of Human SLC34A2 protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.