Recombinant Human Sodium-dependent phosphate transport protein 2B (SLC34A2), partial

Product Overview

• Article Name: Recombinant Human Sodium-dependent phosphate transport protein 2B (SLC34A2), partial
• Biozol Catalog Number: BYT-ORB246790
• Supplier Catalog Number: orb246790
• Alternative Catalog Number: BYT-ORB246790-1,BYT-ORB246790-100,BYT-ORB246790-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Na(+)-dependent phosphate cotransporter 2BNaPi3bSodium/phosphate cotransporter 2B , Na(+)/Pi cotransporter 2B , NaPi-2bSolute carrier family 34 member 2

Product Description

This Recombinant Human Sodium-dependent phosphate transport protein 2B (SLC34A2), partial spans the amino acid sequence from region 574-689aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 15.1 kDa
• UniProt: O95436
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Homo sapiens (Human)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: LLQSRCPRVLPKKLQNWNFLPLWMRSLKPWDAVVSKFTGCFQMRCCCCCRVCCRACCLLCDCPKCCRCSKCCEDLEEAQEGQDVPVKAPETFDNITISREAQGEVPASDSKTECTA

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Images

Western blot analysis of Human SLC34A2 protein

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.