Recombinant Human Alkaline phosphatase, placental type (ALPP) (Active)

Produktübersicht

• Artikelname: Recombinant Human Alkaline phosphatase, placental type (ALPP) (Active)
• Artikelnummer: BYT-ORB2658864
• Hersteller Artikelnummer: orb2658864
• Alternativnummer: BYT-ORB2658864-20,BYT-ORB2658864-100,BYT-ORB2658864-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Alkaline phosphatase Regan isozyme, Placental alkaline phosphatase 1

Produktbeschreibung

This Recombinant Human Alkaline phosphatase, placental type (ALPP) (Active) spans the amino acid sequence from region 23-506aa. Purity: Greater than 95% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 54.1 kDa
• UniProt: P05187
• Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 95% as determined by SDS-PAGE.
• Formulierung: Lyophilized powder
• Sequenz: IIPVEEENPDFWNREAAEALGAAKKLQPAQTAAKNLIIFLGDGMGVSTVTAARILKGQKKDKLGPEIPLAMDRFPYVALSKTYNVDKHVPDSGATATAYLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFRMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKRQGARYVWNRTELMQ

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human ALPP at 2 µg/mL can bind Anti-ALPP/ALPG recombinant antibody. The EC50 is 4.478-5.236 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized Human ALPP at 2 µg/ml can bind Anti-ALPP/ALPG recombinant antibody. The EC50 is 4.478-5.236 ng/mL.

The purity of ALPP was greater than 95% as determined by SEC-HPLC