Recombinant Human Alkaline phosphatase, placental type (ALPP) (Active)

Product Overview

• Article Name: Recombinant Human Alkaline phosphatase, placental type (ALPP) (Active)
• Biozol Catalog Number: BYT-ORB2658864
• Supplier Catalog Number: orb2658864
• Alternative Catalog Number: BYT-ORB2658864-20,BYT-ORB2658864-100,BYT-ORB2658864-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Alkaline phosphatase Regan isozyme, Placental alkaline phosphatase 1

Product Description

This Recombinant Human Alkaline phosphatase, placental type (ALPP) (Active) spans the amino acid sequence from region 23-506aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 54.1 kDa
• UniProt: P05187
• Buffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
• Source: Homo sapiens (Human)
• Purity: Greater than 95% as determined by SDS-PAGE.
• Form: Lyophilized powder
• Sequence: IIPVEEENPDFWNREAAEALGAAKKLQPAQTAAKNLIIFLGDGMGVSTVTAARILKGQKKDKLGPEIPLAMDRFPYVALSKTYNVDKHVPDSGATATAYLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFRMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKRQGARYVWNRTELMQ

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human ALPP at 2 µg/mL can bind Anti-ALPP/ALPG recombinant antibody. The EC50 is 4.478-5.236 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized Human ALPP at 2 µg/ml can bind Anti-ALPP/ALPG recombinant antibody. The EC50 is 4.478-5.236 ng/mL.

The purity of ALPP was greater than 95% as determined by SEC-HPLC