Recombinant Hepatitis C virus Genome polyprotein

Artikelnummer: BYT-ORB2932793
Artikelname: Recombinant Hepatitis C virus Genome polyprotein
Artikelnummer: BYT-ORB2932793
Hersteller Artikelnummer: orb2932793
Alternativnummer: BYT-ORB2932793-20,BYT-ORB2932793-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Genome polyprotein, Cleaved into the following 4 chains:, 1. Core protein p21, Capsid protein C, p21, Core protein p19, Envelope glycoprotein E1, gp32, gp35, Envelope g
This Recombinant Hepatitis C virus Genome polyprotein spans the amino acid sequence from region 384-513.
UniProt: P27959
Puffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Quelle: Hepatitis C virus (isolate HC-J2) (HCV)
Formulierung: Lyophilized powder
Sequenz: TTHVTGGATGHTTSGIASLFLPGASQKIQLINTNGSWHINRTALNCNDSLNTGFLAALFY THKFNASGCPERLASCRSIDGFDQGWGPITYTEPGDSDQKPYCWHYAPQRCSVVSAADVC GPVYCFTPSP
Anwendungsbeschreibung: Biological Origin: Hepatitis C virus (isolate HC-J2) (HCV)