Recombinant Hepatitis C virus Genome polyprotein

Catalog Number: BYT-ORB2932793
Article Name: Recombinant Hepatitis C virus Genome polyprotein
Biozol Catalog Number: BYT-ORB2932793
Supplier Catalog Number: orb2932793
Alternative Catalog Number: BYT-ORB2932793-20,BYT-ORB2932793-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Genome polyprotein, Cleaved into the following 4 chains:, 1. Core protein p21, Capsid protein C, p21, Core protein p19, Envelope glycoprotein E1, gp32, gp35, Envelope g
This Recombinant Hepatitis C virus Genome polyprotein spans the amino acid sequence from region 384-513.
UniProt: P27959
Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Source: Hepatitis C virus (isolate HC-J2) (HCV)
Form: Lyophilized powder
Sequence: TTHVTGGATGHTTSGIASLFLPGASQKIQLINTNGSWHINRTALNCNDSLNTGFLAALFY THKFNASGCPERLASCRSIDGFDQGWGPITYTEPGDSDQKPYCWHYAPQRCSVVSAADVC GPVYCFTPSP
Application Notes: Biological Origin: Hepatitis C virus (isolate HC-J2) (HCV)