Recombinant Hepatitis C virus Genome polyprotein

Product Overview

• Article Name: Recombinant Hepatitis C virus Genome polyprotein
• Biozol Catalog Number: BYT-ORB2932793
• Supplier Catalog Number: orb2932793
• Alternative Catalog Number: BYT-ORB2932793-20,BYT-ORB2932793-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Genome polyprotein, Cleaved into the following 4 chains:, 1. Core protein p21, Capsid protein C, p21, Core protein p19, Envelope glycoprotein E1, gp32, gp35, Envelope g

Product Description

This Recombinant Hepatitis C virus Genome polyprotein spans the amino acid sequence from region 384-513.

Product Properties

• UniProt: P27959
• Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Source: Hepatitis C virus (isolate HC-J2) (HCV)
• Form: Lyophilized powder
• Sequence: TTHVTGGATGHTTSGIASLFLPGASQKIQLINTNGSWHINRTALNCNDSLNTGFLAALFY THKFNASGCPERLASCRSIDGFDQGWGPITYTEPGDSDQKPYCWHYAPQRCSVVSAADVC GPVYCFTPSP

Application Notes

• Application Notes: Biological Origin: Hepatitis C virus (isolate HC-J2) (HCV)