Recombinant Human Contactin-2 (CNTN2), partial, Biotinylated

Artikelnummer: BYT-ORB3008813
Artikelname: Recombinant Human Contactin-2 (CNTN2), partial, Biotinylated
Artikelnummer: BYT-ORB3008813
Hersteller Artikelnummer: orb3008813
Alternativnummer: BYT-ORB3008813-1, BYT-ORB3008813-100, BYT-ORB3008813-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Contactin-2, Axonal glycoprotein TAG-1, Axonin-1, Transient axonal glycoprotein 1, TAX-1, CNTN2 AXT TAG1 TAX1
This Recombinant Human Contactin-2 (CNTN2), partial, Biotinylated spans the amino acid sequence from region 610-708. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: Q02246
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: PPGGVVVRDIGDTTIQLSWSRGFDNHSPIAKYTLQARTPPAGKWKQVRTNPANIEGNAETAQVLGLTPWMDYEFRVIASNILGTGEPSGPSSKIRTREA
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)