Recombinant Human Contactin-2 (CNTN2), partial, Biotinylated

Product Overview

• Article Name: Recombinant Human Contactin-2 (CNTN2), partial, Biotinylated
• Biozol Catalog Number: BYT-ORB3008813
• Supplier Catalog Number: orb3008813
• Alternative Catalog Number: BYT-ORB3008813-1, BYT-ORB3008813-100, BYT-ORB3008813-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Contactin-2, Axonal glycoprotein TAG-1, Axonin-1, Transient axonal glycoprotein 1, TAX-1, CNTN2 AXT TAG1 TAX1

Product Description

This Recombinant Human Contactin-2 (CNTN2), partial, Biotinylated spans the amino acid sequence from region 610-708. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• UniProt: Q02246
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: PPGGVVVRDIGDTTIQLSWSRGFDNHSPIAKYTLQARTPPAGKWKQVRTNPANIEGNAETAQVLGLTPWMDYEFRVIASNILGTGEPSGPSSKIRTREA

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human)