Recombinant Human Protein kinase C epsilon type (KPCE), Biotinylated

Artikelnummer: BYT-ORB3008816
Artikelname: Recombinant Human Protein kinase C epsilon type (KPCE), Biotinylated
Artikelnummer: BYT-ORB3008816
Hersteller Artikelnummer: orb3008816
Alternativnummer: BYT-ORB3008816-1, BYT-ORB3008816-100, BYT-ORB3008816-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Protein kinase C epsilon type, EC 2.7.11.13, nPKC-epsilon, PRKCE PKCE
This Recombinant Human Protein kinase C epsilon type (KPCE), Biotinylated spans the amino acid sequence from region 1-737. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: Q02156
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MVVFNGLLKIKICEAVSLKPTAWSLRHAVGPRPQTFLLDPYIALNVDDSRIGQTATKQKTNSPAWHDEFVTDVCNGRKIELAVFHDAPIGYDDFVANCTIQFEELLQNGSRHFEDWIDLEPEGRVYVIIDLSGSSGEAPKDNEERVFRERMRPRKRQGAVRRRVHQVNGHKFMATYLRQPTYCSHCRDFIWGVIGKQGYQCQVCTCVVHKRCHELIITKCAGLKKQETPDQVGSQRFSVNMPHKFGIHNYKVPTF
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)