Recombinant Human Protein kinase C epsilon type (KPCE), Biotinylated

Product Overview

• Article Name: Recombinant Human Protein kinase C epsilon type (KPCE), Biotinylated
• Biozol Catalog Number: BYT-ORB3008816
• Supplier Catalog Number: orb3008816
• Alternative Catalog Number: BYT-ORB3008816-1, BYT-ORB3008816-100, BYT-ORB3008816-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Protein kinase C epsilon type, EC 2.7.11.13, nPKC-epsilon, PRKCE PKCE

Product Description

This Recombinant Human Protein kinase C epsilon type (KPCE), Biotinylated spans the amino acid sequence from region 1-737. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• UniProt: Q02156
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MVVFNGLLKIKICEAVSLKPTAWSLRHAVGPRPQTFLLDPYIALNVDDSRIGQTATKQKTNSPAWHDEFVTDVCNGRKIELAVFHDAPIGYDDFVANCTIQFEELLQNGSRHFEDWIDLEPEGRVYVIIDLSGSSGEAPKDNEERVFRERMRPRKRQGAVRRRVHQVNGHKFMATYLRQPTYCSHCRDFIWGVIGKQGYQCQVCTCVVHKRCHELIITKCAGLKKQETPDQVGSQRFSVNMPHKFGIHNYKVPTF

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human)