Recombinant Human Guanylate cyclase soluble subunit beta-1 (GCYB1), Biotinylated

Artikelnummer: BYT-ORB3008817
Artikelname: Recombinant Human Guanylate cyclase soluble subunit beta-1 (GCYB1), Biotinylated
Artikelnummer: BYT-ORB3008817
Hersteller Artikelnummer: orb3008817
Alternativnummer: BYT-ORB3008817-1, BYT-ORB3008817-100, BYT-ORB3008817-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Guanylate cyclase soluble subunit beta-1, GCS-beta-1, EC 4.6.1.2, Guanylate cyclase soluble subunit beta-3, GCS-beta-3, Soluble guanylate cyclase small subunit, GUCY1B1 GUC1B3 GUCSB3 GUCY1B3
This Recombinant Human Guanylate cyclase soluble subunit beta-1 (GCYB1), Biotinylated spans the amino acid sequence from region 1-619. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: Q02153
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQRNEECDHTQFLIEEKESKEEDFYEDLDRFEENGTQESRISPYTFCKAFPFHIIFDRDLVVTQCGNAIYRVLPQLQPGNCSLLSVFS
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)