Recombinant Human Guanylate cyclase soluble subunit beta-1 (GCYB1), Biotinylated

Catalog Number: BYT-ORB3008817
Article Name: Recombinant Human Guanylate cyclase soluble subunit beta-1 (GCYB1), Biotinylated
Biozol Catalog Number: BYT-ORB3008817
Supplier Catalog Number: orb3008817
Alternative Catalog Number: BYT-ORB3008817-1, BYT-ORB3008817-100, BYT-ORB3008817-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Guanylate cyclase soluble subunit beta-1, GCS-beta-1, EC 4.6.1.2, Guanylate cyclase soluble subunit beta-3, GCS-beta-3, Soluble guanylate cyclase small subunit, GUCY1B1 GUC1B3 GUCSB3 GUCY1B3
This Recombinant Human Guanylate cyclase soluble subunit beta-1 (GCYB1), Biotinylated spans the amino acid sequence from region 1-619. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: Q02153
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQRNEECDHTQFLIEEKESKEEDFYEDLDRFEENGTQESRISPYTFCKAFPFHIIFDRDLVVTQCGNAIYRVLPQLQPGNCSLLSVFS
Application Notes: Biological Origin: Homo sapiens (Human)