Recombinant Human Transcription factor Sp2 (SP2), Biotinylated

Artikelnummer: BYT-ORB3008819
Artikelname: Recombinant Human Transcription factor Sp2 (SP2), Biotinylated
Artikelnummer: BYT-ORB3008819
Hersteller Artikelnummer: orb3008819
Alternativnummer: BYT-ORB3008819-1, BYT-ORB3008819-100, BYT-ORB3008819-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Transcription factor Sp2 SP2 KIAA0048
This Recombinant Human Transcription factor Sp2 (SP2), Biotinylated spans the amino acid sequence from region 1-613. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: Q02086
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MSDPQTSMAATAAVSPSDYLQPAASTTQDSQPSPLALLAATCSKIGPPAVEAAVTPPAPPQPTPRKLVPIKPAPLPLSPGKNSFGILSSKGNILQIQGSQLSASYPGGQLVFAIQNPTMINKGTRSNANIQYQAVPQIQASNSQTIQVQPNLTNQIQIIPGTNQAIITPSPSSHKPVPIKPAPIQKSSTTTTPVQSGANVVKLTGGGGNVTLTLPVNNLVNASDTGAPTQLLTESPPTPLSKTNKKARKKSLPAS
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)