Recombinant Human Transcription factor Sp2 (SP2), Biotinylated

Catalog Number: BYT-ORB3008819
Article Name: Recombinant Human Transcription factor Sp2 (SP2), Biotinylated
Biozol Catalog Number: BYT-ORB3008819
Supplier Catalog Number: orb3008819
Alternative Catalog Number: BYT-ORB3008819-1, BYT-ORB3008819-100, BYT-ORB3008819-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Transcription factor Sp2 SP2 KIAA0048
This Recombinant Human Transcription factor Sp2 (SP2), Biotinylated spans the amino acid sequence from region 1-613. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: Q02086
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSDPQTSMAATAAVSPSDYLQPAASTTQDSQPSPLALLAATCSKIGPPAVEAAVTPPAPPQPTPRKLVPIKPAPLPLSPGKNSFGILSSKGNILQIQGSQLSASYPGGQLVFAIQNPTMINKGTRSNANIQYQAVPQIQASNSQTIQVQPNLTNQIQIIPGTNQAIITPSPSSHKPVPIKPAPIQKSSTTTTPVQSGANVVKLTGGGGNVTLTLPVNNLVNASDTGAPTQLLTESPPTPLSKTNKKARKKSLPAS
Application Notes: Biological Origin: Homo sapiens (Human)