Recombinant Human 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 (PLCB3), partial, Biotinylated

Artikelnummer: BYT-ORB3008822
Artikelname: Recombinant Human 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 (PLCB3), partial, Biotinylated
Artikelnummer: BYT-ORB3008822
Hersteller Artikelnummer: orb3008822
Alternativnummer: BYT-ORB3008822-1, BYT-ORB3008822-100, BYT-ORB3008822-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3, EC 3.1.4.11, Phosphoinositide phospholipase C-beta-3, Phospholipase C-beta-3, PLC-beta-3, PLCB3
This Recombinant Human 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 (PLCB3), partial, Biotinylated spans the amino acid sequence from region 318-468. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: Q01970
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: DMTQPLSAYFINSSHNTYLTAGQLAGTSSVEMYRQALLWGCRCVELDVWKGRPPEEEPFITHGFTMTTEVPLRDVLEAIAETAFKTSPYPVILSFENHVDSAKQQAKMAEYCRSIFGDALLIEPLDKYPLAPGVPLPSPQDLMGRILVKNK
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)