Recombinant Human 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 (PLCB3), partial, Biotinylated

Catalog Number: BYT-ORB3008822
Article Name: Recombinant Human 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 (PLCB3), partial, Biotinylated
Biozol Catalog Number: BYT-ORB3008822
Supplier Catalog Number: orb3008822
Alternative Catalog Number: BYT-ORB3008822-1, BYT-ORB3008822-100, BYT-ORB3008822-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3, EC 3.1.4.11, Phosphoinositide phospholipase C-beta-3, Phospholipase C-beta-3, PLC-beta-3, PLCB3
This Recombinant Human 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 (PLCB3), partial, Biotinylated spans the amino acid sequence from region 318-468. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: Q01970
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: DMTQPLSAYFINSSHNTYLTAGQLAGTSSVEMYRQALLWGCRCVELDVWKGRPPEEEPFITHGFTMTTEVPLRDVLEAIAETAFKTSPYPVILSFENHVDSAKQQAKMAEYCRSIFGDALLIEPLDKYPLAPGVPLPSPQDLMGRILVKNK
Application Notes: Biological Origin: Homo sapiens (Human)