Recombinant Human POU domain, class 4, transcription factor 1 (PO4F1), Biotinylated

Produktübersicht

• Artikelname: Recombinant Human POU domain, class 4, transcription factor 1 (PO4F1), Biotinylated
• Artikelnummer: BYT-ORB3008825
• Hersteller Artikelnummer: orb3008825
• Alternativnummer: BYT-ORB3008825-1, BYT-ORB3008825-100, BYT-ORB3008825-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: POU domain, class 4, transcription factor 1, Brain-specific homeobox/POU domain protein 3A, Brain-3A, Brn-3A, Homeobox/POU domain protein RDC-1, Oct-T1, POU4F1 BRN3A RDC1

Produktbeschreibung

This Recombinant Human POU domain, class 4, transcription factor 1 (PO4F1), Biotinylated spans the amino acid sequence from region 1-419. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• UniProt: Q01851
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MMSMNSKQPHFAMHPTLPEHKYPSLHSSSEAIRRACLPTPPLQSNLFASLDETLLARAEALAAVDIAVSQGKSHPFKPDATYHTMNSVPCTSTSTVPLAHHHHHHHHHQALEPGDLLDHISSPSLALMAGAGGAGAAAGGGGAHDGPGGGGGPGGGGGPGGGPGGGGGGGPGGGGGGPGGGLLGGSAHPHPHMHSLGHLSHPAAAAAMNMPSGLPHPGLVAAAAHHGAAAAAAAAAAGQVAAASAAAAVVGAAGL

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)