Recombinant Human POU domain, class 4, transcription factor 1 (PO4F1), Biotinylated

Catalog Number: BYT-ORB3008825
Article Name: Recombinant Human POU domain, class 4, transcription factor 1 (PO4F1), Biotinylated
Biozol Catalog Number: BYT-ORB3008825
Supplier Catalog Number: orb3008825
Alternative Catalog Number: BYT-ORB3008825-1, BYT-ORB3008825-100, BYT-ORB3008825-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: POU domain, class 4, transcription factor 1, Brain-specific homeobox/POU domain protein 3A, Brain-3A, Brn-3A, Homeobox/POU domain protein RDC-1, Oct-T1, POU4F1 BRN3A RDC1
This Recombinant Human POU domain, class 4, transcription factor 1 (PO4F1), Biotinylated spans the amino acid sequence from region 1-419. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: Q01851
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MMSMNSKQPHFAMHPTLPEHKYPSLHSSSEAIRRACLPTPPLQSNLFASLDETLLARAEALAAVDIAVSQGKSHPFKPDATYHTMNSVPCTSTSTVPLAHHHHHHHHHQALEPGDLLDHISSPSLALMAGAGGAGAAAGGGGAHDGPGGGGGPGGGGGPGGGPGGGGGGGPGGGGGGPGGGLLGGSAHPHPHMHSLGHLSHPAAAAAMNMPSGLPHPGLVAAAAHHGAAAAAAAAAAGQVAAASAAAAVVGAAGL
Application Notes: Biological Origin: Homo sapiens (Human)