Recombinant Human RNA-binding protein EWS (EWS), Biotinylated

Produktübersicht

• Artikelname: Recombinant Human RNA-binding protein EWS (EWS), Biotinylated
• Artikelnummer: BYT-ORB3008826
• Hersteller Artikelnummer: orb3008826
• Alternativnummer: BYT-ORB3008826-1, BYT-ORB3008826-100, BYT-ORB3008826-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: RNA-binding protein EWS, EWS oncogene, Ewing sarcoma breakpoint region 1 protein, EWSR1 EWS

Produktbeschreibung

This Recombinant Human RNA-binding protein EWS (EWS), Biotinylated spans the amino acid sequence from region 1-656. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• UniProt: Q01844
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MASTDYSTYSQAAAQQGYSAYTAQPTQGYAQTTQAYGQQSYGTYGQPTDVSYTQAQTTATYGQTAYATSYGQPPTGYTTPTAPQAYSQPVQGYGTGAYDTTTATVTTTQASYAAQSAYGTQPAYPAYGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGYGQSNYSYPQVPGSYPMQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQPSSYGQQSSYGQQSSYGQQPPTSYPPQTGSYSQAPSQYS

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)