Recombinant Human RNA-binding protein EWS (EWS), Biotinylated

Catalog Number: BYT-ORB3008826
Article Name: Recombinant Human RNA-binding protein EWS (EWS), Biotinylated
Biozol Catalog Number: BYT-ORB3008826
Supplier Catalog Number: orb3008826
Alternative Catalog Number: BYT-ORB3008826-1, BYT-ORB3008826-100, BYT-ORB3008826-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: RNA-binding protein EWS, EWS oncogene, Ewing sarcoma breakpoint region 1 protein, EWSR1 EWS
This Recombinant Human RNA-binding protein EWS (EWS), Biotinylated spans the amino acid sequence from region 1-656. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: Q01844
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MASTDYSTYSQAAAQQGYSAYTAQPTQGYAQTTQAYGQQSYGTYGQPTDVSYTQAQTTATYGQTAYATSYGQPPTGYTTPTAPQAYSQPVQGYGTGAYDTTTATVTTTQASYAAQSAYGTQPAYPAYGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGYGQSNYSYPQVPGSYPMQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQPSSYGQQSSYGQQSSYGQQPPTSYPPQTGSYSQAPSQYS
Application Notes: Biological Origin: Homo sapiens (Human)