Recombinant Human ATP-dependent 6-phosphofructokinase, platelet type (PFKAP), Biotinylated

Artikelnummer: BYT-ORB3008828
Artikelname: Recombinant Human ATP-dependent 6-phosphofructokinase, platelet type (PFKAP), Biotinylated
Artikelnummer: BYT-ORB3008828
Hersteller Artikelnummer: orb3008828
Alternativnummer: BYT-ORB3008828-1, BYT-ORB3008828-100, BYT-ORB3008828-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: ATP-dependent 6-phosphofructokinase, platelet type, ATP-PFK, PFK-P, EC 2.7.1.11, 6-phosphofructokinase type C, Phosphofructo-1-kinase isozyme C, PFK-C, Phosphohexokinase, PFKP PFKF
This Recombinant Human ATP-dependent 6-phosphofructokinase, platelet type (PFKAP), Biotinylated spans the amino acid sequence from region 1-784. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: Q01813
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MDADDSRAPKGSLRKFLEHLSGAGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFIYEGYQGMVDGGSNIAEADWESVSSILQVGGTIIGSARCQAFRTREGRLKAACNLLQRGITNLCVIGGDGSLTGANLFRKEWSGLLEELARNGQIDKEAVQKYAYLNVVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFLPESPPEEGWEEQMCVK
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)