Recombinant Human ATP-dependent 6-phosphofructokinase, platelet type (PFKAP), Biotinylated

Product Overview

• Article Name: Recombinant Human ATP-dependent 6-phosphofructokinase, platelet type (PFKAP), Biotinylated
• Biozol Catalog Number: BYT-ORB3008828
• Supplier Catalog Number: orb3008828
• Alternative Catalog Number: BYT-ORB3008828-1, BYT-ORB3008828-100, BYT-ORB3008828-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: ATP-dependent 6-phosphofructokinase, platelet type, ATP-PFK, PFK-P, EC 2.7.1.11, 6-phosphofructokinase type C, Phosphofructo-1-kinase isozyme C, PFK-C, Phosphohexokinase, PFKP PFKF

Product Description

This Recombinant Human ATP-dependent 6-phosphofructokinase, platelet type (PFKAP), Biotinylated spans the amino acid sequence from region 1-784. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• UniProt: Q01813
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MDADDSRAPKGSLRKFLEHLSGAGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFIYEGYQGMVDGGSNIAEADWESVSSILQVGGTIIGSARCQAFRTREGRLKAACNLLQRGITNLCVIGGDGSLTGANLFRKEWSGLLEELARNGQIDKEAVQKYAYLNVVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFLPESPPEEGWEEQMCVK

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human)