Recombinant Human OTU domain-containing protein 4 (OTUD4), partial, Biotinylated

Artikelnummer: BYT-ORB3008829
Artikelname: Recombinant Human OTU domain-containing protein 4 (OTUD4), partial, Biotinylated
Artikelnummer: BYT-ORB3008829
Hersteller Artikelnummer: orb3008829
Alternativnummer: BYT-ORB3008829-1, BYT-ORB3008829-100, BYT-ORB3008829-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: OTU domain-containing protein 4, EC 3.4.19.12, HIV-1-induced protein HIN-1, OTUD4 HIN-1 KIAA1046
This Recombinant Human OTU domain-containing protein 4 (OTUD4), partial, Biotinylated spans the amino acid sequence from region 34-155. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: Q01804
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: LYRKLVAKDGSCLFRAVAEQVLHSQSRHVEVRMACIHYLRENREKFEAFIEGSFEEYLKRLENPQEWVGQVEISALSLMYRKDFIIYREPNVSPSQVTENNFPEKVLLCFSNGNHYDIVYPI
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)