Recombinant Human OTU domain-containing protein 4 (OTUD4), partial, Biotinylated

Product Overview

• Article Name: Recombinant Human OTU domain-containing protein 4 (OTUD4), partial, Biotinylated
• Biozol Catalog Number: BYT-ORB3008829
• Supplier Catalog Number: orb3008829
• Alternative Catalog Number: BYT-ORB3008829-1, BYT-ORB3008829-100, BYT-ORB3008829-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: OTU domain-containing protein 4, EC 3.4.19.12, HIV-1-induced protein HIN-1, OTUD4 HIN-1 KIAA1046

Product Description

This Recombinant Human OTU domain-containing protein 4 (OTUD4), partial, Biotinylated spans the amino acid sequence from region 34-155. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• UniProt: Q01804
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: LYRKLVAKDGSCLFRAVAEQVLHSQSRHVEVRMACIHYLRENREKFEAFIEGSFEEYLKRLENPQEWVGQVEISALSLMYRKDFIIYREPNVSPSQVTENNFPEKVLLCFSNGNHYDIVYPI

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human)