Recombinant Human Interferon-induced transmembrane protein 3 (IFM3), partial, Biotinylated

Produktübersicht

• Artikelname: Recombinant Human Interferon-induced transmembrane protein 3 (IFM3), partial, Biotinylated
• Artikelnummer: BYT-ORB3008835
• Hersteller Artikelnummer: orb3008835
• Alternativnummer: BYT-ORB3008835-1, BYT-ORB3008835-100, BYT-ORB3008835-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Interferon-induced transmembrane protein 3, Dispanin subfamily A member 2b, DSPA2b, Interferon-inducible protein 1-8U, IFITM3

Produktbeschreibung

This Recombinant Human Interferon-induced transmembrane protein 3 (IFM3), partial, Biotinylated spans the amino acid sequence from region 1-57. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• UniProt: Q01628
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDH

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)