Recombinant Human Interferon-induced transmembrane protein 3 (IFM3), partial, Biotinylated

Catalog Number: BYT-ORB3008835
Article Name: Recombinant Human Interferon-induced transmembrane protein 3 (IFM3), partial, Biotinylated
Biozol Catalog Number: BYT-ORB3008835
Supplier Catalog Number: orb3008835
Alternative Catalog Number: BYT-ORB3008835-1, BYT-ORB3008835-100, BYT-ORB3008835-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Interferon-induced transmembrane protein 3, Dispanin subfamily A member 2b, DSPA2b, Interferon-inducible protein 1-8U, IFITM3
This Recombinant Human Interferon-induced transmembrane protein 3 (IFM3), partial, Biotinylated spans the amino acid sequence from region 1-57. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: Q01628
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDH
Application Notes: Biological Origin: Homo sapiens (Human)