Recombinant Human Testis-specific Y-encoded protein 1 (TSPY1), Biotinylated

Produktübersicht

• Artikelname: Recombinant Human Testis-specific Y-encoded protein 1 (TSPY1), Biotinylated
• Artikelnummer: BYT-ORB3008837
• Hersteller Artikelnummer: orb3008837
• Alternativnummer: BYT-ORB3008837-1, BYT-ORB3008837-100, BYT-ORB3008837-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Testis-specific Y-encoded protein 1, Cancer/testis antigen 78, CT78, TSPY1 TSPY

Produktbeschreibung

This Recombinant Human Testis-specific Y-encoded protein 1 (TSPY1), Biotinylated spans the amino acid sequence from region 1-308. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• UniProt: Q01534
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MRPEGSLTYRVPERLRQGFCGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALGEEAVLLLDDIMAEVEVVAEEEGLVERREEAQRAQQAVPGPGPMTPESAPEELLAVQVELEPVNAQARKAFSRQREKMERRRKPHLDRRGAVIQSVPGFWANVIANHPQMSALITDEDEDMLSYMVSLEVGEEKHPVHLCKIMLFFRSNPYFQNKVITKEYLVNITEYRASHSTPIEWYPDYEVEAYRRRHHNSSL

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)