Recombinant Human Testis-specific Y-encoded protein 1 (TSPY1), Biotinylated

Catalog Number: BYT-ORB3008837
Article Name: Recombinant Human Testis-specific Y-encoded protein 1 (TSPY1), Biotinylated
Biozol Catalog Number: BYT-ORB3008837
Supplier Catalog Number: orb3008837
Alternative Catalog Number: BYT-ORB3008837-1, BYT-ORB3008837-100, BYT-ORB3008837-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Testis-specific Y-encoded protein 1, Cancer/testis antigen 78, CT78, TSPY1 TSPY
This Recombinant Human Testis-specific Y-encoded protein 1 (TSPY1), Biotinylated spans the amino acid sequence from region 1-308. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: Q01534
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MRPEGSLTYRVPERLRQGFCGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALGEEAVLLLDDIMAEVEVVAEEEGLVERREEAQRAQQAVPGPGPMTPESAPEELLAVQVELEPVNAQARKAFSRQREKMERRRKPHLDRRGAVIQSVPGFWANVIANHPQMSALITDEDEDMLSYMVSLEVGEEKHPVHLCKIMLFFRSNPYFQNKVITKEYLVNITEYRASHSTPIEWYPDYEVEAYRRRHHNSSL
Application Notes: Biological Origin: Homo sapiens (Human)