Recombinant Human Desmocollin-2 (DSC2), partial, Biotinylated

Artikelnummer: BYT-ORB3008838
Artikelname: Recombinant Human Desmocollin-2 (DSC2), partial, Biotinylated
Artikelnummer: BYT-ORB3008838
Hersteller Artikelnummer: orb3008838
Alternativnummer: BYT-ORB3008838-1, BYT-ORB3008838-100, BYT-ORB3008838-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Desmocollin-2, Cadherin family member 2, Desmocollin-3, Desmosomal glycoprotein II, Desmosomal glycoprotein III, DSC2 CDHF2 DSC3
This Recombinant Human Desmocollin-2 (DSC2), partial, Biotinylated spans the amino acid sequence from region 136-694. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: Q02487
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: RWAPIPCSMLENSLGPFPLFLQQVQSDTAQNYTIYYSIRGPGVDQEPRNLFYVERDTGNLYCTRPVDREQYESFEIIAFATTPDGYTPELPLPLIIKIEDENDNYPIFTEETYTFTIFENCRVGTTVGQVCATDKDEPDTMHTRLKYSIIGQVPPSPTLFSMHPTTGVITTTSSQLDRELIDKYQLKIKVQDMDGQYFGLQTTSTCIINIDDVNDHLPTFTRTSYVTSVEENTVDVEILRVTVEDKDLVNTANWR
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)