Recombinant Human Desmocollin-2 (DSC2), partial, Biotinylated

Catalog Number: BYT-ORB3008838
Article Name: Recombinant Human Desmocollin-2 (DSC2), partial, Biotinylated
Biozol Catalog Number: BYT-ORB3008838
Supplier Catalog Number: orb3008838
Alternative Catalog Number: BYT-ORB3008838-1, BYT-ORB3008838-100, BYT-ORB3008838-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Desmocollin-2, Cadherin family member 2, Desmocollin-3, Desmosomal glycoprotein II, Desmosomal glycoprotein III, DSC2 CDHF2 DSC3
This Recombinant Human Desmocollin-2 (DSC2), partial, Biotinylated spans the amino acid sequence from region 136-694. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: Q02487
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: RWAPIPCSMLENSLGPFPLFLQQVQSDTAQNYTIYYSIRGPGVDQEPRNLFYVERDTGNLYCTRPVDREQYESFEIIAFATTPDGYTPELPLPLIIKIEDENDNYPIFTEETYTFTIFENCRVGTTVGQVCATDKDEPDTMHTRLKYSIIGQVPPSPTLFSMHPTTGVITTTSSQLDRELIDKYQLKIKVQDMDGQYFGLQTTSTCIINIDDVNDHLPTFTRTSYVTSVEENTVDVEILRVTVEDKDLVNTANWR
Application Notes: Biological Origin: Homo sapiens (Human)