Recombinant Human Transcription factor RelB (RELB), Biotinylated

Artikelnummer: BYT-ORB3008843
Artikelname: Recombinant Human Transcription factor RelB (RELB), Biotinylated
Artikelnummer: BYT-ORB3008843
Hersteller Artikelnummer: orb3008843
Alternativnummer: BYT-ORB3008843-1, BYT-ORB3008843-100, BYT-ORB3008843-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Transcription factor RelB, I-Rel, RELB
This Recombinant Human Transcription factor RelB (RELB), Biotinylated spans the amino acid sequence from region 1-579. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: Q01201
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MLRSGPASGPSVPTGRAMPSRRVARPPAAPELGALGSPDLSSLSLAVSRSTDELEIIDEYIKENGFGLDGGQPGPGEGLPRLVSRGAASLSTVTLGPVAPPATPPPWGCPLGRLVSPAPGPGPQPHLVITEQPKQRGMRFRYECEGRSAGSILGESSTEASKTLPAIELRDCGGLREVEVTACLVWKDWPHRVHPHSLVGKDCTDGICRVRLRPHVSPRHSFNNLGIQCVRKKEIEAAIERKIQLGIDPYNAGSL
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)