Recombinant Human Transcription factor RelB (RELB), Biotinylated

Product Overview

• Article Name: Recombinant Human Transcription factor RelB (RELB), Biotinylated
• Biozol Catalog Number: BYT-ORB3008843
• Supplier Catalog Number: orb3008843
• Alternative Catalog Number: BYT-ORB3008843-1, BYT-ORB3008843-100, BYT-ORB3008843-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Transcription factor RelB, I-Rel, RELB

Product Description

This Recombinant Human Transcription factor RelB (RELB), Biotinylated spans the amino acid sequence from region 1-579. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• UniProt: Q01201
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MLRSGPASGPSVPTGRAMPSRRVARPPAAPELGALGSPDLSSLSLAVSRSTDELEIIDEYIKENGFGLDGGQPGPGEGLPRLVSRGAASLSTVTLGPVAPPATPPPWGCPLGRLVSPAPGPGPQPHLVITEQPKQRGMRFRYECEGRSAGSILGESSTEASKTLPAIELRDCGGLREVEVTACLVWKDWPHRVHPHSLVGKDCTDGICRVRLRPHVSPRHSFNNLGIQCVRKKEIEAAIERKIQLGIDPYNAGSL

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human)