Recombinant Human Forkhead box protein K2 (FOXK2), Biotinylated

Artikelnummer: BYT-ORB3008844
Artikelname: Recombinant Human Forkhead box protein K2 (FOXK2), Biotinylated
Artikelnummer: BYT-ORB3008844
Hersteller Artikelnummer: orb3008844
Alternativnummer: BYT-ORB3008844-1, BYT-ORB3008844-100, BYT-ORB3008844-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Forkhead box protein K2, G/T-mismatch specific binding protein, nGTBP, Interleukin enhancer-binding factor 1, FOXK2 ILF ILF1
This Recombinant Human Forkhead box protein K2 (FOXK2), Biotinylated spans the amino acid sequence from region 2-660. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: Q01167
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: AAAAAALSGAGTPPAGGGAGGGGAGGGGSPPGGWAVARLEGREFEYLMKKRSVTIGRNSSQGSVDVSMGHSSFISRRHLEIFTPPGGGGHGGAAPELPPAQPRPDAGGDFYLRCLGKNGVFVDGVFQRRGAPPLQLPRVCTFRFPSTNIKITFTALSSEKREKQEASESPVKAVQPHISPLTINIPDTMAHLISPLPSPTGTISAANSCPSSPRGAGSSGYKVGRVMPSDLNLMADNSQPENEKEASGGDSPKDD
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)