Recombinant Human Forkhead box protein K2 (FOXK2), Biotinylated

Catalog Number: BYT-ORB3008844
Article Name: Recombinant Human Forkhead box protein K2 (FOXK2), Biotinylated
Biozol Catalog Number: BYT-ORB3008844
Supplier Catalog Number: orb3008844
Alternative Catalog Number: BYT-ORB3008844-1, BYT-ORB3008844-100, BYT-ORB3008844-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Forkhead box protein K2, G/T-mismatch specific binding protein, nGTBP, Interleukin enhancer-binding factor 1, FOXK2 ILF ILF1
This Recombinant Human Forkhead box protein K2 (FOXK2), Biotinylated spans the amino acid sequence from region 2-660. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: Q01167
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: AAAAAALSGAGTPPAGGGAGGGGAGGGGSPPGGWAVARLEGREFEYLMKKRSVTIGRNSSQGSVDVSMGHSSFISRRHLEIFTPPGGGGHGGAAPELPPAQPRPDAGGDFYLRCLGKNGVFVDGVFQRRGAPPLQLPRVCTFRFPSTNIKITFTALSSEKREKQEASESPVKAVQPHISPLTINIPDTMAHLISPLPSPTGTISAANSCPSSPRGAGSSGYKVGRVMPSDLNLMADNSQPENEKEASGGDSPKDD
Application Notes: Biological Origin: Homo sapiens (Human)