Recombinant Human Sodium channel protein type 7 subunit alpha (SCN7A), partial, Biotinylated

Produktübersicht

• Artikelname: Recombinant Human Sodium channel protein type 7 subunit alpha (SCN7A), partial, Biotinylated
• Artikelnummer: BYT-ORB3008845
• Hersteller Artikelnummer: orb3008845
• Alternativnummer: BYT-ORB3008845-1, BYT-ORB3008845-100, BYT-ORB3008845-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Sodium channel protein type 7 subunit alpha, Atypical sodium channel Nav2.1, Nax channel, Sodium channel protein type VII subunit alpha, SCN7A SCN6A

Produktbeschreibung

This Recombinant Human Sodium channel protein type 7 subunit alpha (SCN7A), partial, Biotinylated spans the amino acid sequence from region 260-338. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• UniProt: Q01118
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MGNLKHKCFRWPQENENETLHNRTGNPYYIRETENFYYLEGERYALLCGNRTDAGQCPEGYVCVKAGINPDQGFTNFDS

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)