Recombinant Human Sodium channel protein type 7 subunit alpha (SCN7A), partial, Biotinylated

Catalog Number: BYT-ORB3008845
Article Name: Recombinant Human Sodium channel protein type 7 subunit alpha (SCN7A), partial, Biotinylated
Biozol Catalog Number: BYT-ORB3008845
Supplier Catalog Number: orb3008845
Alternative Catalog Number: BYT-ORB3008845-1, BYT-ORB3008845-100, BYT-ORB3008845-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Sodium channel protein type 7 subunit alpha, Atypical sodium channel Nav2.1, Nax channel, Sodium channel protein type VII subunit alpha, SCN7A SCN6A
This Recombinant Human Sodium channel protein type 7 subunit alpha (SCN7A), partial, Biotinylated spans the amino acid sequence from region 260-338. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: Q01118
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MGNLKHKCFRWPQENENETLHNRTGNPYYIRETENFYYLEGERYALLCGNRTDAGQCPEGYVCVKAGINPDQGFTNFDS
Application Notes: Biological Origin: Homo sapiens (Human)